Description
Product Description
Protein Description: cytokine like 1
Gene Name: CYTL1
Alternative Gene Name: C17, C4orf4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000062329: 78%, ENSRNOG00000028108: 78%
Entrez Gene ID: 54360
Uniprot ID: Q9NRR1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: CYTL1
Alternative Gene Name: C17, C4orf4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000062329: 78%, ENSRNOG00000028108: 78%
Entrez Gene ID: 54360
Uniprot ID: Q9NRR1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | TCYSRMRALSQEITRDFNLLQVSEPSEPCVRYLPRLYLDIHNYCVLDKLRDFVAS |
Gene Sequence | TCYSRMRALSQEITRDFNLLQVSEPSEPCVRYLPRLYLDIHNYCVLDKLRDFVAS |
Gene ID - Mouse | ENSMUSG00000062329 |
Gene ID - Rat | ENSRNOG00000028108 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti CYTL1 pAb (ATL-HPA067201) | |
Datasheet | Anti CYTL1 pAb (ATL-HPA067201) Datasheet (External Link) |
Vendor Page | Anti CYTL1 pAb (ATL-HPA067201) at Atlas Antibodies |
Documents & Links for Anti CYTL1 pAb (ATL-HPA067201) | |
Datasheet | Anti CYTL1 pAb (ATL-HPA067201) Datasheet (External Link) |
Vendor Page | Anti CYTL1 pAb (ATL-HPA067201) |