Anti CYTL1 pAb (ATL-HPA067201)

Atlas Antibodies

Catalog No: ATL-HPA067201-25

• 

Product Description

Protein Description: cytokine like 1
Gene Name: CYTL1
Alternative Gene Name: C17, C4orf4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000062329: 78%, ENSRNOG00000028108: 78%
Entrez Gene ID: 54360
Uniprot ID: Q9NRR1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: TCYSRMRALSQEITRDFNLLQVSEPSEPCVRYLPRLYLDIHNYCVLDKLRDFVAS
• Gene Sequence: TCYSRMRALSQEITRDFNLLQVSEPSEPCVRYLPRLYLDIHNYCVLDKLRDFVAS
• Gene ID - Mouse: ENSMUSG00000062329
• Gene ID - Rat: ENSRNOG00000028108
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.