Anti CYR61 pAb (ATL-HPA029853)

Catalog No:
ATL-HPA029853-25
$360.00
Protein Description: cysteine-rich, angiogenic inducer, 61
Gene Name: CYR61
Alternative Gene Name: CCN1, GIG1, IGFBP10
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028195: 100%, ENSRNOG00000014350: 100%
Entrez Gene ID: 3491
Uniprot ID: O00622
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Gene Sequence CGCCKVCAKQLNEDCSKTQPCDHTKGLECNFGASSTALKGICRAQSEGRPCEYNSRIYQNGESFQPNCKHQCTCIDGAV

Documents & Links for Anti CYR61 pAb (ATL-HPA029853)
Datasheet Anti CYR61 pAb (ATL-HPA029853) Datasheet (External Link)
Vendor Page Anti CYR61 pAb (ATL-HPA029853) at Atlas

Documents & Links for Anti CYR61 pAb (ATL-HPA029853)
Datasheet Anti CYR61 pAb (ATL-HPA029853) Datasheet (External Link)
Vendor Page Anti CYR61 pAb (ATL-HPA029853)

Citations for Anti CYR61 pAb (ATL-HPA029853) – 3 Found
Wnorowski, Artur; Dudzik, Danuta; Bernier, Michel; Wójcik, Jakub; Keijzers, Guido; Diaz-Ruiz, Alberto; Mazur, Karolina; Zhang, Yongqing; Han, Haiyong; Scheibye-Knudsen, Morten; Jozwiak, Krzysztof; Barbas, Coral; Wainer, Irving W. Deprogramming metabolism in pancreatic cancer with a bi-functional GPR55 inhibitor and biased β(2) adrenergic agonist. Scientific Reports. 2022;12(1):3618.  PubMed
Schlage, Pascal; Kockmann, Tobias; Sabino, Fabio; Kizhakkedathu, Jayachandran N; Auf dem Keller, Ulrich. Matrix Metalloproteinase 10 Degradomics in Keratinocytes and Epidermal Tissue Identifies Bioactive Substrates With Pleiotropic Functions. Molecular & Cellular Proteomics : Mcp. 2015;14(12):3234-46.  PubMed
Li, Xin; Pishdari, Bano; Cui, Peng; Hu, Min; Yang, Hong-Ping; Guo, Yan-Rong; Jiang, Hong-Yuan; Feng, Yi; Billig, Håkan; Shao, Ruijin. Regulation of Androgen Receptor Expression Alters AMPK Phosphorylation in the Endometrium: In Vivo and In Vitro Studies in Women with Polycystic Ovary Syndrome. International Journal Of Biological Sciences. 11(12):1376-89.  PubMed