Protein Description: cytochrome P450, family 2, subfamily B, polypeptide 6
Gene Name: CYP2B6
Alternative Gene Name: CPB6, CYP2B, CYPIIB6
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030483: 82%, ENSRNOG00000033680: 82%
Entrez Gene ID: 1555
Uniprot ID: P20813
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: CYP2B6
Alternative Gene Name: CPB6, CYP2B, CYPIIB6
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030483: 82%, ENSRNOG00000033680: 82%
Entrez Gene ID: 1555
Uniprot ID: P20813
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | EAQCLIEELRKSKGALVDPTFLFHSITANIICSI |
| Documents & Links for Anti CYP2B6 pAb (ATL-HPA062973) | |
| Datasheet | Anti CYP2B6 pAb (ATL-HPA062973) Datasheet (External Link) |
| Vendor Page | Anti CYP2B6 pAb (ATL-HPA062973) at Atlas |
| Documents & Links for Anti CYP2B6 pAb (ATL-HPA062973) | |
| Datasheet | Anti CYP2B6 pAb (ATL-HPA062973) Datasheet (External Link) |
| Vendor Page | Anti CYP2B6 pAb (ATL-HPA062973) |