Protein Description: cytochrome P450, family 27, subfamily C, polypeptide 1
Gene Name: CYP27C1
Alternative Gene Name: FLJ16008
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026170: 48%, ENSRNOG00000017188: 48%
Entrez Gene ID: 339761
Uniprot ID: Q4G0S4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: CYP27C1
Alternative Gene Name: FLJ16008
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026170: 48%, ENSRNOG00000017188: 48%
Entrez Gene ID: 339761
Uniprot ID: Q4G0S4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | FPVLPGNGRVTQEDLVIGGYLIPKGTQLALCHYATSYQDENFPRAKEFRPERWLRKGDLDRVDNFGSIPFGHGVRS |
| Documents & Links for Anti CYP27C1 pAb (ATL-HPA068731) | |
| Datasheet | Anti CYP27C1 pAb (ATL-HPA068731) Datasheet (External Link) |
| Vendor Page | Anti CYP27C1 pAb (ATL-HPA068731) at Atlas |
| Documents & Links for Anti CYP27C1 pAb (ATL-HPA068731) | |
| Datasheet | Anti CYP27C1 pAb (ATL-HPA068731) Datasheet (External Link) |
| Vendor Page | Anti CYP27C1 pAb (ATL-HPA068731) |