Description
Product Description
Protein Description: cytochrome P450, family 27, subfamily C, polypeptide 1
Gene Name: CYP27C1
Alternative Gene Name: FLJ16008
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026170: 48%, ENSRNOG00000017188: 48%
Entrez Gene ID: 339761
Uniprot ID: Q4G0S4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: CYP27C1
Alternative Gene Name: FLJ16008
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026170: 48%, ENSRNOG00000017188: 48%
Entrez Gene ID: 339761
Uniprot ID: Q4G0S4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | FPVLPGNGRVTQEDLVIGGYLIPKGTQLALCHYATSYQDENFPRAKEFRPERWLRKGDLDRVDNFGSIPFGHGVRS |
Gene Sequence | FPVLPGNGRVTQEDLVIGGYLIPKGTQLALCHYATSYQDENFPRAKEFRPERWLRKGDLDRVDNFGSIPFGHGVRS |
Gene ID - Mouse | ENSMUSG00000026170 |
Gene ID - Rat | ENSRNOG00000017188 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti CYP27C1 pAb (ATL-HPA068731) | |
Datasheet | Anti CYP27C1 pAb (ATL-HPA068731) Datasheet (External Link) |
Vendor Page | Anti CYP27C1 pAb (ATL-HPA068731) at Atlas Antibodies |
Documents & Links for Anti CYP27C1 pAb (ATL-HPA068731) | |
Datasheet | Anti CYP27C1 pAb (ATL-HPA068731) Datasheet (External Link) |
Vendor Page | Anti CYP27C1 pAb (ATL-HPA068731) |