Anti CYP27C1 pAb (ATL-HPA062460)

Atlas Antibodies

Catalog No: ATL-HPA062460-25

• 

Product Description

Protein Description: cytochrome P450 family 27 subfamily C member 1
Gene Name: CYP27C1
Alternative Gene Name: FLJ16008
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038567: 43%, ENSRNOG00000046214: 42%
Entrez Gene ID: 339761
Uniprot ID: Q4G0S4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: TTSFTLSWTVYLLARHPEVQQTVYREIVKNLGERHVPTAADVPKVPLVRALLK
• Gene Sequence: TTSFTLSWTVYLLARHPEVQQTVYREIVKNLGERHVPTAADVPKVPLVRALLK
• Gene ID - Mouse: ENSMUSG00000038567
• Gene ID - Rat: ENSRNOG00000046214
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.