Description
Product Description
Protein Description: cytochrome P450, family 27, subfamily A, polypeptide 1
Gene Name: CYP27A1
Alternative Gene Name: CP27, CTX, CYP27
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026170: 67%, ENSRNOG00000017188: 69%
Entrez Gene ID: 1593
Uniprot ID: Q02318
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: CYP27A1
Alternative Gene Name: CP27, CTX, CYP27
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026170: 67%, ENSRNOG00000017188: 69%
Entrez Gene ID: 1593
Uniprot ID: Q02318
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | WB, ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | RQRSLEEIPRLGQLRFFFQLFVQGYALQLHQLQVLYKAKYGPMWMSYLGPQMHVNLASAPLLEQVMRQEGKYPVRNDMELWKEHRDQHDLTYGPFTTEGHHWYQLRQALNQRLLKPAEAALYTDAFNEVIDDFMTRLD |
Gene Sequence | RQRSLEEIPRLGQLRFFFQLFVQGYALQLHQLQVLYKAKYGPMWMSYLGPQMHVNLASAPLLEQVMRQEGKYPVRNDMELWKEHRDQHDLTYGPFTTEGHHWYQLRQALNQRLLKPAEAALYTDAFNEVIDDFMTRLD |
Gene ID - Mouse | ENSMUSG00000026170 |
Gene ID - Rat | ENSRNOG00000017188 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti CYP27A1 pAb (ATL-HPA059155 w/enhanced validation) | |
Datasheet | Anti CYP27A1 pAb (ATL-HPA059155 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti CYP27A1 pAb (ATL-HPA059155 w/enhanced validation) at Atlas Antibodies |
Documents & Links for Anti CYP27A1 pAb (ATL-HPA059155 w/enhanced validation) | |
Datasheet | Anti CYP27A1 pAb (ATL-HPA059155 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti CYP27A1 pAb (ATL-HPA059155 w/enhanced validation) |