Anti CYP20A1 pAb (ATL-HPA055872)
Atlas Antibodies
- SKU:
- ATL-HPA055872-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: CYP20A1
Alternative Gene Name: CYP-M
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000049439: 95%, ENSRNOG00000017631: 93%
Entrez Gene ID: 57404
Uniprot ID: Q6UW02
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | PGITPTEEKDGNLPDIVNSGSLHEFLVNLHERYGPVVSFWFGRRLVVSLGTVDVLKQHINPNKTLDPFETMLKSL |
Gene Sequence | PGITPTEEKDGNLPDIVNSGSLHEFLVNLHERYGPVVSFWFGRRLVVSLGTVDVLKQHINPNKTLDPFETMLKSL |
Gene ID - Mouse | ENSMUSG00000049439 |
Gene ID - Rat | ENSRNOG00000017631 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti CYP20A1 pAb (ATL-HPA055872) | |
Datasheet | Anti CYP20A1 pAb (ATL-HPA055872) Datasheet (External Link) |
Vendor Page | Anti CYP20A1 pAb (ATL-HPA055872) at Atlas Antibodies |
Documents & Links for Anti CYP20A1 pAb (ATL-HPA055872) | |
Datasheet | Anti CYP20A1 pAb (ATL-HPA055872) Datasheet (External Link) |
Vendor Page | Anti CYP20A1 pAb (ATL-HPA055872) |