Anti CYP11B1 pAb (ATL-HPA056348)

Atlas Antibodies

Catalog No: ATL-HPA056348-25

• 

Product Description

Protein Description: cytochrome P450, family 11, subfamily B, polypeptide 1
Gene Name: CYP11B1
Alternative Gene Name: CPN1, CYP11B, FHI, P450C11
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022589: 71%, ENSRNOG00000030111: 72%
Entrez Gene ID: 1584
Uniprot ID: P15538
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: RFLPMVDAVARDFSQALKKKVLQNARGSLTLDVQPSIFHYTIEASNLALFGERLGLVGHSPSSASLNFLHALEVMFKSTVQLMFMPR
• Gene Sequence: RFLPMVDAVARDFSQALKKKVLQNARGSLTLDVQPSIFHYTIEASNLALFGERLGLVGHSPSSASLNFLHALEVMFKSTVQLMFMPR
• Gene ID - Mouse: ENSMUSG00000022589
• Gene ID - Rat: ENSRNOG00000030111
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations

Citations for Anti CYP11B1 pAb (ATL-HPA056348) – 2 Found

Phan, Truong San; Schink, Leonhard; Mann, Jasmin; Merk, Verena M; Zwicky, Pascale; Mundt, Sarah; Simon, Dagmar; Kulms, Dagmar; Abraham, Susanne; Legler, Daniel F; Noti, Mario; Brunner, Thomas. Keratinocytes control skin immune homeostasis through de novo-synthesized glucocorticoids. Science Advances. 2021;7(5) 

Merk, Verena M; Grob, Leonie; Fleischmann, Achim; Brunner, Thomas. Human lung carcinomas synthesize immunoregulatory glucocorticoids. Genes And Immunity. 2023;24(1):52-56.