Protein Description: cylicin, basic protein of sperm head cytoskeleton 1
Gene Name: CYLC1
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000073001: 40%, ENSRNOG00000056740: 39%
Entrez Gene ID: 1538
Uniprot ID: P35663
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: CYLC1
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000073001: 40%, ENSRNOG00000056740: 39%
Entrez Gene ID: 1538
Uniprot ID: P35663
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | KKDSKKDDKKKDAKKNAESTEMESDLELKKDKKHSKEKKGSKKDIKKDARKDTESTDAEFDESSKTGFKTSTKIKGSDTESEESLYKP |
| Documents & Links for Anti CYLC1 pAb (ATL-HPA070355 w/enhanced validation) | |
| Datasheet | Anti CYLC1 pAb (ATL-HPA070355 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti CYLC1 pAb (ATL-HPA070355 w/enhanced validation) at Atlas |
| Documents & Links for Anti CYLC1 pAb (ATL-HPA070355 w/enhanced validation) | |
| Datasheet | Anti CYLC1 pAb (ATL-HPA070355 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti CYLC1 pAb (ATL-HPA070355 w/enhanced validation) |