Protein Description: cytoplasmic FMR1 interacting protein 2
Gene Name: CYFIP2
Alternative Gene Name: PIR121
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020340: 100%, ENSRNOG00000010348: 40%
Entrez Gene ID: 26999
Uniprot ID: Q96F07
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: CYFIP2
Alternative Gene Name: PIR121
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020340: 100%, ENSRNOG00000010348: 40%
Entrez Gene ID: 26999
Uniprot ID: Q96F07
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | STQACQWSPRALFHPTGGTQGRRGCRSLLY |
| Documents & Links for Anti CYFIP2 pAb (ATL-HPA071459) | |
| Datasheet | Anti CYFIP2 pAb (ATL-HPA071459) Datasheet (External Link) |
| Vendor Page | Anti CYFIP2 pAb (ATL-HPA071459) at Atlas |
| Documents & Links for Anti CYFIP2 pAb (ATL-HPA071459) | |
| Datasheet | Anti CYFIP2 pAb (ATL-HPA071459) Datasheet (External Link) |
| Vendor Page | Anti CYFIP2 pAb (ATL-HPA071459) |