Protein Description: cytoplasmic FMR1 interacting protein 1
Gene Name: CYFIP1
Alternative Gene Name: KIAA0068, P140SRA-1, SHYC
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030447: 100%, ENSRNOG00000011945: 100%
Entrez Gene ID: 23191
Uniprot ID: Q7L576
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: CYFIP1
Alternative Gene Name: KIAA0068, P140SRA-1, SHYC
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030447: 100%, ENSRNOG00000011945: 100%
Entrez Gene ID: 23191
Uniprot ID: Q7L576
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | TLGKFINMFAVLDELKNMKCSVKNDHSAYKRAAQFLRKMADPQSIQESQNLSMFLANHN |
| Documents & Links for Anti CYFIP1 pAb (ATL-HPA068106) | |
| Datasheet | Anti CYFIP1 pAb (ATL-HPA068106) Datasheet (External Link) |
| Vendor Page | Anti CYFIP1 pAb (ATL-HPA068106) at Atlas |
| Documents & Links for Anti CYFIP1 pAb (ATL-HPA068106) | |
| Datasheet | Anti CYFIP1 pAb (ATL-HPA068106) Datasheet (External Link) |
| Vendor Page | Anti CYFIP1 pAb (ATL-HPA068106) |