Anti CYFIP1 pAb (ATL-HPA068106)

Atlas Antibodies

Catalog No: ATL-HPA068106-25

• 

Product Description

Protein Description: cytoplasmic FMR1 interacting protein 1
Gene Name: CYFIP1
Alternative Gene Name: KIAA0068, P140SRA-1, SHYC
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030447: 100%, ENSRNOG00000011945: 100%
Entrez Gene ID: 23191
Uniprot ID: Q7L576
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: TLGKFINMFAVLDELKNMKCSVKNDHSAYKRAAQFLRKMADPQSIQESQNLSMFLANHN
• Gene Sequence: TLGKFINMFAVLDELKNMKCSVKNDHSAYKRAAQFLRKMADPQSIQESQNLSMFLANHN
• Gene ID - Mouse: ENSMUSG00000030447
• Gene ID - Rat: ENSRNOG00000011945
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.