Anti CYB5R2 pAb (ATL-HPA061707 w/enhanced validation)

Atlas Antibodies

Catalog No: ATL-HPA061707-25

• 

Product Description

Protein Description: cytochrome b5 reductase 2
Gene Name: CYB5R2
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000048065: 83%, ENSRNOG00000019751: 80%
Entrez Gene ID: 51700
Uniprot ID: Q6BCY4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: NQTEEDILVRKELEEIARTHPDQFNLWYTLDRPPIGWKYSSGFVTA
• Gene Sequence: NQTEEDILVRKELEEIARTHPDQFNLWYTLDRPPIGWKYSSGFVTA
• Gene ID - Mouse: ENSMUSG00000048065
• Gene ID - Rat: ENSRNOG00000019751
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.