Description
Product Description
Protein Description: chromosome X open reading frame 56
Gene Name: CXorf56
Alternative Gene Name: FLJ22965
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000006423: 99%, ENSRNOG00000012564: 99%
Entrez Gene ID: 63932
Uniprot ID: Q9H5V9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: CXorf56
Alternative Gene Name: FLJ22965
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000006423: 99%, ENSRNOG00000012564: 99%
Entrez Gene ID: 63932
Uniprot ID: Q9H5V9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | WB, ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | MGKFSSVTVSTIDEEEEEIEAREVADSYAQNAKVIEKQLERKGMSKRRLQELAELEAKKAKMKGTLIDNQFQ |
Gene Sequence | MGKFSSVTVSTIDEEEEEIEAREVADSYAQNAKVIEKQLERKGMSKRRLQELAELEAKKAKMKGTLIDNQFQ |
Gene ID - Mouse | ENSMUSG00000006423 |
Gene ID - Rat | ENSRNOG00000012564 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti CXorf56 pAb (ATL-HPA064831) | |
Datasheet | Anti CXorf56 pAb (ATL-HPA064831) Datasheet (External Link) |
Vendor Page | Anti CXorf56 pAb (ATL-HPA064831) at Atlas Antibodies |
Documents & Links for Anti CXorf56 pAb (ATL-HPA064831) | |
Datasheet | Anti CXorf56 pAb (ATL-HPA064831) Datasheet (External Link) |
Vendor Page | Anti CXorf56 pAb (ATL-HPA064831) |