Protein Description: chromosome X open reading frame 56
Gene Name: CXorf56
Alternative Gene Name: FLJ22965
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000006423: 99%, ENSRNOG00000012564: 99%
Entrez Gene ID: 63932
Uniprot ID: Q9H5V9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: CXorf56
Alternative Gene Name: FLJ22965
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000006423: 99%, ENSRNOG00000012564: 99%
Entrez Gene ID: 63932
Uniprot ID: Q9H5V9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | MGKFSSVTVSTIDEEEEEIEAREVADSYAQNAKVIEKQLERKGMSKRRLQELAELEAKKAKMKGTLIDNQFQ |
| Documents & Links for Anti CXorf56 pAb (ATL-HPA064831) | |
| Datasheet | Anti CXorf56 pAb (ATL-HPA064831) Datasheet (External Link) |
| Vendor Page | Anti CXorf56 pAb (ATL-HPA064831) at Atlas |
| Documents & Links for Anti CXorf56 pAb (ATL-HPA064831) | |
| Datasheet | Anti CXorf56 pAb (ATL-HPA064831) Datasheet (External Link) |
| Vendor Page | Anti CXorf56 pAb (ATL-HPA064831) |