Anti CXorf56 pAb (ATL-HPA064831)

Catalog No:
ATL-HPA064831-100
$596.00

Description

Product Description

Protein Description: chromosome X open reading frame 56
Gene Name: CXorf56
Alternative Gene Name: FLJ22965
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000006423: 99%, ENSRNOG00000012564: 99%
Entrez Gene ID: 63932
Uniprot ID: Q9H5V9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application WB, ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MGKFSSVTVSTIDEEEEEIEAREVADSYAQNAKVIEKQLERKGMSKRRLQELAELEAKKAKMKGTLIDNQFQ
Gene Sequence MGKFSSVTVSTIDEEEEEIEAREVADSYAQNAKVIEKQLERKGMSKRRLQELAELEAKKAKMKGTLIDNQFQ
Gene ID - Mouse ENSMUSG00000006423
Gene ID - Rat ENSRNOG00000012564
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti CXorf56 pAb (ATL-HPA064831)
Datasheet Anti CXorf56 pAb (ATL-HPA064831) Datasheet (External Link)
Vendor Page Anti CXorf56 pAb (ATL-HPA064831) at Atlas Antibodies

Documents & Links for Anti CXorf56 pAb (ATL-HPA064831)
Datasheet Anti CXorf56 pAb (ATL-HPA064831) Datasheet (External Link)
Vendor Page Anti CXorf56 pAb (ATL-HPA064831)

Product Description

Protein Description: chromosome X open reading frame 56
Gene Name: CXorf56
Alternative Gene Name: FLJ22965
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000006423: 99%, ENSRNOG00000012564: 99%
Entrez Gene ID: 63932
Uniprot ID: Q9H5V9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application WB, ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MGKFSSVTVSTIDEEEEEIEAREVADSYAQNAKVIEKQLERKGMSKRRLQELAELEAKKAKMKGTLIDNQFQ
Gene Sequence MGKFSSVTVSTIDEEEEEIEAREVADSYAQNAKVIEKQLERKGMSKRRLQELAELEAKKAKMKGTLIDNQFQ
Gene ID - Mouse ENSMUSG00000006423
Gene ID - Rat ENSRNOG00000012564
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti CXorf56 pAb (ATL-HPA064831)
Datasheet Anti CXorf56 pAb (ATL-HPA064831) Datasheet (External Link)
Vendor Page Anti CXorf56 pAb (ATL-HPA064831) at Atlas Antibodies

Documents & Links for Anti CXorf56 pAb (ATL-HPA064831)
Datasheet Anti CXorf56 pAb (ATL-HPA064831) Datasheet (External Link)
Vendor Page Anti CXorf56 pAb (ATL-HPA064831)