Protein Description: C-X3-C motif chemokine receptor 1
Gene Name: CX3CR1
Alternative Gene Name: CCRL1, CMKBRL1, CMKDR1, GPR13, V28
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000052336: 67%, ENSRNOG00000018509: 65%
Entrez Gene ID: 1524
Uniprot ID: P49238
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: CX3CR1
Alternative Gene Name: CCRL1, CMKBRL1, CMKDR1, GPR13, V28
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000052336: 67%, ENSRNOG00000018509: 65%
Entrez Gene ID: 1524
Uniprot ID: P49238
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | HLYGKCLAVLCGRSVHVDFSSSESQRSRHGSVLSSNFTYHTSDGDA |
Documents & Links for Anti CX3CR1 pAb (ATL-HPA077743) | |
Datasheet | Anti CX3CR1 pAb (ATL-HPA077743) Datasheet (External Link) |
Vendor Page | Anti CX3CR1 pAb (ATL-HPA077743) at Atlas |
Documents & Links for Anti CX3CR1 pAb (ATL-HPA077743) | |
Datasheet | Anti CX3CR1 pAb (ATL-HPA077743) Datasheet (External Link) |
Vendor Page | Anti CX3CR1 pAb (ATL-HPA077743) |