Protein Description: CUB and zona pellucida-like domains 1
Gene Name: CUZD1
Alternative Gene Name: ERG-1, UO-44
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040205: 83%, ENSRNOG00000029945: 89%
Entrez Gene ID: 50624
Uniprot ID: Q86UP6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: CUZD1
Alternative Gene Name: ERG-1, UO-44
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040205: 83%, ENSRNOG00000029945: 89%
Entrez Gene ID: 50624
Uniprot ID: Q86UP6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | QVSLRASDPNLVVFLDTCRASPTSDFASPTYDLIKSGCSRDETCKVYPLFGHYGRFQFNAFKFLRSMSSVYL |
Documents & Links for Anti CUZD1 pAb (ATL-HPA068479 w/enhanced validation) | |
Datasheet | Anti CUZD1 pAb (ATL-HPA068479 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti CUZD1 pAb (ATL-HPA068479 w/enhanced validation) at Atlas |
Documents & Links for Anti CUZD1 pAb (ATL-HPA068479 w/enhanced validation) | |
Datasheet | Anti CUZD1 pAb (ATL-HPA068479 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti CUZD1 pAb (ATL-HPA068479 w/enhanced validation) |