![Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251 MG](https://cdn11.bigcommerce.com/s-ydswqc5qsc/images/stencil/500x659/products/99342/178865/atl-hpa064369_anti-cuta-pab-atl-hpa064369_60527__05583.1681134437.jpg?c=2 "Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251 MG")
Protein Description: cutA divalent cation tolerance homolog (E. coli)
Gene Name: CUTA
Alternative Gene Name: ACHAP, C6orf82
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024194: 91%, ENSRNOG00000000481: 89%
Entrez Gene ID: 51596
Uniprot ID: O60888
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: CUTA
Alternative Gene Name: ACHAP, C6orf82
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024194: 91%, ENSRNOG00000000481: 89%
Entrez Gene ID: 51596
Uniprot ID: O60888
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | TSIYEWKGKIEEDSEVLMMIKTQSSLVPALTDFVRSVHPYEVAEVIALPVEQGNFPYLQWVRQVTESVSDSITVLP |
| Documents & Links for Anti CUTA pAb (ATL-HPA064369) | |
| Datasheet | Anti CUTA pAb (ATL-HPA064369) Datasheet (External Link) |
| Vendor Page | Anti CUTA pAb (ATL-HPA064369) at Atlas |
| Documents & Links for Anti CUTA pAb (ATL-HPA064369) | |
| Datasheet | Anti CUTA pAb (ATL-HPA064369) Datasheet (External Link) |
| Vendor Page | Anti CUTA pAb (ATL-HPA064369) |