Anti CUL4B pAb (ATL-HPA058979)

Catalog No:
ATL-HPA058979-25
$395.00

Description

Product Description

Protein Description: cullin 4B
Gene Name: CUL4B
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031446: 100%, ENSRNOG00000019649: 100%
Entrez Gene ID: 8450
Uniprot ID: Q13620
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen KHKLFRIKINQIQMKETVEEQVSTTERVFQDRQYQIDAAIVRIM
Gene Sequence KHKLFRIKINQIQMKETVEEQVSTTERVFQDRQYQIDAAIVRIM
Gene ID - Mouse ENSMUSG00000031446
Gene ID - Rat ENSRNOG00000019649
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti CUL4B pAb (ATL-HPA058979)
Datasheet Anti CUL4B pAb (ATL-HPA058979) Datasheet (External Link)
Vendor Page Anti CUL4B pAb (ATL-HPA058979) at Atlas Antibodies

Documents & Links for Anti CUL4B pAb (ATL-HPA058979)
Datasheet Anti CUL4B pAb (ATL-HPA058979) Datasheet (External Link)
Vendor Page Anti CUL4B pAb (ATL-HPA058979)

Product Description

Protein Description: cullin 4B
Gene Name: CUL4B
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031446: 100%, ENSRNOG00000019649: 100%
Entrez Gene ID: 8450
Uniprot ID: Q13620
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen KHKLFRIKINQIQMKETVEEQVSTTERVFQDRQYQIDAAIVRIM
Gene Sequence KHKLFRIKINQIQMKETVEEQVSTTERVFQDRQYQIDAAIVRIM
Gene ID - Mouse ENSMUSG00000031446
Gene ID - Rat ENSRNOG00000019649
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti CUL4B pAb (ATL-HPA058979)
Datasheet Anti CUL4B pAb (ATL-HPA058979) Datasheet (External Link)
Vendor Page Anti CUL4B pAb (ATL-HPA058979) at Atlas Antibodies

Documents & Links for Anti CUL4B pAb (ATL-HPA058979)
Datasheet Anti CUL4B pAb (ATL-HPA058979) Datasheet (External Link)
Vendor Page Anti CUL4B pAb (ATL-HPA058979)