Protein Description: cytosolic thiouridylase subunit 2 homolog (S. pombe)
Gene Name: CTU2
Alternative Gene Name: C16orf84, NCS2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000049482: 69%, ENSRNOG00000051531: 70%
Entrez Gene ID: 348180
Uniprot ID: Q2VPK5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: CTU2
Alternative Gene Name: C16orf84, NCS2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000049482: 69%, ENSRNOG00000051531: 70%
Entrez Gene ID: 348180
Uniprot ID: Q2VPK5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | LSPDSFCLGFSEGAACGQSLEERSKTLAEVKPILQATGFPWHVVALEEVFSLPPSVLWCSAQELVGSEGAYKAAVDSFLQQQH |
| Gene Sequence | LSPDSFCLGFSEGAACGQSLEERSKTLAEVKPILQATGFPWHVVALEEVFSLPPSVLWCSAQELVGSEGAYKAAVDSFLQQQH |
| Gene ID - Mouse | ENSMUSG00000049482 |
| Gene ID - Rat | ENSRNOG00000051531 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti CTU2 pAb (ATL-HPA041135) | |
| Datasheet | Anti CTU2 pAb (ATL-HPA041135) Datasheet (External Link) |
| Vendor Page | Anti CTU2 pAb (ATL-HPA041135) at Atlas |
| Documents & Links for Anti CTU2 pAb (ATL-HPA041135) | |
| Datasheet | Anti CTU2 pAb (ATL-HPA041135) Datasheet (External Link) |
| Vendor Page | Anti CTU2 pAb (ATL-HPA041135) |