Anti CTTN pAb (ATL-HPA057242)

Atlas Antibodies

Catalog No: ATL-HPA057242-100

• 
• 
• 

Product Description

Protein Description: cortactin
Gene Name: CTTN
Alternative Gene Name: EMS1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031078: 96%, ENSRNOG00000047280: 97%
Entrez Gene ID: 2017
Uniprot ID: Q14247
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: GFGGKFGVQTDRQDKCALGWDHQEKLQLHESQKDYKTGFGGKFGVQSERQDSAAVGFDYKEKLAKHESQQDYSKGF
• Gene Sequence: GFGGKFGVQTDRQDKCALGWDHQEKLQLHESQKDYKTGFGGKFGVQSERQDSAAVGFDYKEKLAKHESQQDYSKGF
• Gene ID - Mouse: ENSMUSG00000031078
• Gene ID - Rat: ENSRNOG00000047280
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.