Description
Product Description
Protein Description: cathepsin L
Gene Name: CTSL
Alternative Gene Name: CTSL1, FLJ31037
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021477: 50%, ENSRNOG00000018566: 53%
Entrez Gene ID: 1514
Uniprot ID: P07711
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: CTSL
Alternative Gene Name: CTSL1, FLJ31037
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021477: 50%, ENSRNOG00000018566: 53%
Entrez Gene ID: 1514
Uniprot ID: P07711
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | WB, ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | GIASATLTFDHSLEAQWTKWKAMHNRLYGM |
Gene Sequence | GIASATLTFDHSLEAQWTKWKAMHNRLYGM |
Gene ID - Mouse | ENSMUSG00000021477 |
Gene ID - Rat | ENSRNOG00000018566 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti CTSL pAb (ATL-HPA070413) | |
Datasheet | Anti CTSL pAb (ATL-HPA070413) Datasheet (External Link) |
Vendor Page | Anti CTSL pAb (ATL-HPA070413) at Atlas Antibodies |
Documents & Links for Anti CTSL pAb (ATL-HPA070413) | |
Datasheet | Anti CTSL pAb (ATL-HPA070413) Datasheet (External Link) |
Vendor Page | Anti CTSL pAb (ATL-HPA070413) |