Anti CTSG pAb (ATL-HPA047737 w/enhanced validation)

Atlas Antibodies

Catalog No: ATL-HPA047737-25

• 

Protein Description: cathepsin G
Gene Name: CTSG
Alternative Gene Name: CG
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040314: 59%, ENSRNOG00000020647: 59%
Entrez Gene ID: 1511
Uniprot ID: P08311
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: GRVSMRRGTDTLREVQLRVQRDRQCLRIFGSYDPRRQICVGDRRERKAAFK
• Gene Sequence: GRVSMRRGTDTLREVQLRVQRDRQCLRIFGSYDPRRQICVGDRRERKAAFK
• Gene ID - Mouse: ENSMUSG00000040314
• Gene ID - Rat: ENSRNOG00000020647
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti CTSG pAb (ATL-HPA047737 w/enhanced validation) – 1 Found

Månberg, Anna; Bradley, Frideborg; Qundos, Ulrika; Guthrie, Brandon L; Birse, Kenzie; Noël-Romas, Laura; Lindskog, Cecilia; Bosire, Rose; Kiarie, James; Farquhar, Carey; Burgener, Adam D; Nilsson, Peter; Broliden, Kristina. A High-throughput Bead-based Affinity Assay Enables Analysis of Genital Protein Signatures in Women At Risk of HIV Infection. Molecular & Cellular Proteomics : Mcp. 2019;18(3):461-476.