Protein Description: cathepsin C
Gene Name: CTSC
Alternative Gene Name: DPP1, PALS, PLS
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030560: 70%, ENSRNOG00000016496: 71%
Entrez Gene ID: 1075
Uniprot ID: P53634
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: CTSC
Alternative Gene Name: DPP1, PALS, PLS
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030560: 70%, ENSRNOG00000016496: 71%
Entrez Gene ID: 1075
Uniprot ID: P53634
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | SQEKYSNRLYKYDHNFVKAINAIQKSWTATTYMEYETLTLGDMIRRSGGHSRKIPRPKPAPLT |
Documents & Links for Anti CTSC pAb (ATL-HPA066610) | |
Datasheet | Anti CTSC pAb (ATL-HPA066610) Datasheet (External Link) |
Vendor Page | Anti CTSC pAb (ATL-HPA066610) at Atlas |
Documents & Links for Anti CTSC pAb (ATL-HPA066610) | |
Datasheet | Anti CTSC pAb (ATL-HPA066610) Datasheet (External Link) |
Vendor Page | Anti CTSC pAb (ATL-HPA066610) |