Anti CTSC pAb (ATL-HPA066610)

Atlas Antibodies

Catalog No: ATL-HPA066610-25

• 

Product Description

Protein Description: cathepsin C
Gene Name: CTSC
Alternative Gene Name: DPP1, PALS, PLS
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030560: 70%, ENSRNOG00000016496: 71%
Entrez Gene ID: 1075
Uniprot ID: P53634
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: SQEKYSNRLYKYDHNFVKAINAIQKSWTATTYMEYETLTLGDMIRRSGGHSRKIPRPKPAPLT
• Gene Sequence: SQEKYSNRLYKYDHNFVKAINAIQKSWTATTYMEYETLTLGDMIRRSGGHSRKIPRPKPAPLT
• Gene ID - Mouse: ENSMUSG00000030560
• Gene ID - Rat: ENSRNOG00000016496
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.