Description
Product Description
Protein Description: cathepsin A
Gene Name: CTSA
Alternative Gene Name: GSL, PPGB
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000017760: 88%, ENSRNOG00000015857: 88%
Entrez Gene ID: 5476
Uniprot ID: P10619
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: CTSA
Alternative Gene Name: GSL, PPGB
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000017760: 88%, ENSRNOG00000015857: 88%
Entrez Gene ID: 5476
Uniprot ID: P10619
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | WB |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | PSMNLQGLAVGNGLSSYEQNDNSLVYFAYYHGLLGNRLWSSLQTHCCSQNKCNFYDNKDLECVTNLQEVARIVGNSGLNIYNLYAPCAGGVPSHFRYEKDTVVVQDLGNIFT |
Gene Sequence | PSMNLQGLAVGNGLSSYEQNDNSLVYFAYYHGLLGNRLWSSLQTHCCSQNKCNFYDNKDLECVTNLQEVARIVGNSGLNIYNLYAPCAGGVPSHFRYEKDTVVVQDLGNIFT |
Gene ID - Mouse | ENSMUSG00000017760 |
Gene ID - Rat | ENSRNOG00000015857 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti CTSA pAb (ATL-HPA072487) | |
Datasheet | Anti CTSA pAb (ATL-HPA072487) Datasheet (External Link) |
Vendor Page | Anti CTSA pAb (ATL-HPA072487) at Atlas Antibodies |
Documents & Links for Anti CTSA pAb (ATL-HPA072487) | |
Datasheet | Anti CTSA pAb (ATL-HPA072487) Datasheet (External Link) |
Vendor Page | Anti CTSA pAb (ATL-HPA072487) |