Anti CTSA pAb (ATL-HPA072487)

Atlas Antibodies

Catalog No: ATL-HPA072487-25

• 

Product Description

Protein Description: cathepsin A
Gene Name: CTSA
Alternative Gene Name: GSL, PPGB
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000017760: 88%, ENSRNOG00000015857: 88%
Entrez Gene ID: 5476
Uniprot ID: P10619
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: PSMNLQGLAVGNGLSSYEQNDNSLVYFAYYHGLLGNRLWSSLQTHCCSQNKCNFYDNKDLECVTNLQEVARIVGNSGLNIYNLYAPCAGGVPSHFRYEKDTVVVQDLGNIFT
• Gene Sequence: PSMNLQGLAVGNGLSSYEQNDNSLVYFAYYHGLLGNRLWSSLQTHCCSQNKCNFYDNKDLECVTNLQEVARIVGNSGLNIYNLYAPCAGGVPSHFRYEKDTVVVQDLGNIFT
• Gene ID - Mouse: ENSMUSG00000017760
• Gene ID - Rat: ENSRNOG00000015857
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.