![Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10 | Lane 2: RT4 | Lane 3: U-251 MG | Lane 4: Human Plasma | Lane 5: Liver | Lane 6: Tonsil](https://cdn11.bigcommerce.com/s-ydswqc5qsc/images/stencil/1280x1280/products/100961/180975/atl-hpa072487_anti-ctsa-pab-atl-hpa072487_62643__64115.1681137193.jpg?c=2 "Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10 | Lane 2: RT4 | Lane 3: U-251 MG | Lane 4: Human Plasma | Lane 5: Liver | Lane 6: Tonsil")
![Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10 | Lane 2: RT4 | Lane 3: U-251 MG | Lane 4: Human Plasma | Lane 5: Liver | Lane 6: Tonsil](https://cdn11.bigcommerce.com/s-ydswqc5qsc/images/stencil/500x659/products/100961/180975/atl-hpa072487_anti-ctsa-pab-atl-hpa072487_62643__64115.1681137193.jpg?c=2 "Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10 | Lane 2: RT4 | Lane 3: U-251 MG | Lane 4: Human Plasma | Lane 5: Liver | Lane 6: Tonsil")
Protein Description: cathepsin A
Gene Name: CTSA
Alternative Gene Name: GSL, PPGB
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000017760: 88%, ENSRNOG00000015857: 88%
Entrez Gene ID: 5476
Uniprot ID: P10619
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: CTSA
Alternative Gene Name: GSL, PPGB
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000017760: 88%, ENSRNOG00000015857: 88%
Entrez Gene ID: 5476
Uniprot ID: P10619
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | PSMNLQGLAVGNGLSSYEQNDNSLVYFAYYHGLLGNRLWSSLQTHCCSQNKCNFYDNKDLECVTNLQEVARIVGNSGLNIYNLYAPCAGGVPSHFRYEKDTVVVQDLGNIFT |
| Documents & Links for Anti CTSA pAb (ATL-HPA072487) | |
| Datasheet | Anti CTSA pAb (ATL-HPA072487) Datasheet (External Link) |
| Vendor Page | Anti CTSA pAb (ATL-HPA072487) at Atlas |
| Documents & Links for Anti CTSA pAb (ATL-HPA072487) | |
| Datasheet | Anti CTSA pAb (ATL-HPA072487) Datasheet (External Link) |
| Vendor Page | Anti CTSA pAb (ATL-HPA072487) |