Protein Description: CTR9, Paf1/RNA polymerase II complex component
Gene Name: CTR9
Alternative Gene Name: KIAA0155, p150TSP, SH2BP1, TSBP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000005609: 100%, ENSRNOG00000017195: 100%
Entrez Gene ID: 9646
Uniprot ID: Q6PD62
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: CTR9
Alternative Gene Name: KIAA0155, p150TSP, SH2BP1, TSBP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000005609: 100%, ENSRNOG00000017195: 100%
Entrez Gene ID: 9646
Uniprot ID: Q6PD62
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | YPDDVEAWIELAQILEQTDIQGALSAYGTATRILQEKVQADVPPEILNNVGALHFRLGNLGEAKKYFLASLDRAKAEAEH |
Documents & Links for Anti CTR9 pAb (ATL-HPA068122 w/enhanced validation) | |
Datasheet | Anti CTR9 pAb (ATL-HPA068122 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti CTR9 pAb (ATL-HPA068122 w/enhanced validation) at Atlas |
Documents & Links for Anti CTR9 pAb (ATL-HPA068122 w/enhanced validation) | |
Datasheet | Anti CTR9 pAb (ATL-HPA068122 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti CTR9 pAb (ATL-HPA068122 w/enhanced validation) |