Protein Description: CTP synthase 2
Gene Name: CTPS2
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031360: 80%, ENSRNOG00000004257: 78%
Entrez Gene ID: 56474
Uniprot ID: Q9NRF8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: CTPS2
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031360: 80%, ENSRNOG00000004257: 78%
Entrez Gene ID: 56474
Uniprot ID: Q9NRF8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | RVPVLLEEQSIVKYFKERLHLPIGDSASNLLFKWRNMADRYERLQKICSIA |
Documents & Links for Anti CTPS2 pAb (ATL-HPA075930) | |
Datasheet | Anti CTPS2 pAb (ATL-HPA075930) Datasheet (External Link) |
Vendor Page | Anti CTPS2 pAb (ATL-HPA075930) at Atlas |
Documents & Links for Anti CTPS2 pAb (ATL-HPA075930) | |
Datasheet | Anti CTPS2 pAb (ATL-HPA075930) Datasheet (External Link) |
Vendor Page | Anti CTPS2 pAb (ATL-HPA075930) |