Anti CTPS2 pAb (ATL-HPA075930)

Catalog No:
ATL-HPA075930-25
$447.00

Description

Product Description

Protein Description: CTP synthase 2
Gene Name: CTPS2
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031360: 80%, ENSRNOG00000004257: 78%
Entrez Gene ID: 56474
Uniprot ID: Q9NRF8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen RVPVLLEEQSIVKYFKERLHLPIGDSASNLLFKWRNMADRYERLQKICSIA
Gene Sequence RVPVLLEEQSIVKYFKERLHLPIGDSASNLLFKWRNMADRYERLQKICSIA
Gene ID - Mouse ENSMUSG00000031360
Gene ID - Rat ENSRNOG00000004257
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti CTPS2 pAb (ATL-HPA075930)
Datasheet Anti CTPS2 pAb (ATL-HPA075930) Datasheet (External Link)
Vendor Page Anti CTPS2 pAb (ATL-HPA075930) at Atlas Antibodies

Documents & Links for Anti CTPS2 pAb (ATL-HPA075930)
Datasheet Anti CTPS2 pAb (ATL-HPA075930) Datasheet (External Link)
Vendor Page Anti CTPS2 pAb (ATL-HPA075930)

Product Description

Protein Description: CTP synthase 2
Gene Name: CTPS2
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031360: 80%, ENSRNOG00000004257: 78%
Entrez Gene ID: 56474
Uniprot ID: Q9NRF8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen RVPVLLEEQSIVKYFKERLHLPIGDSASNLLFKWRNMADRYERLQKICSIA
Gene Sequence RVPVLLEEQSIVKYFKERLHLPIGDSASNLLFKWRNMADRYERLQKICSIA
Gene ID - Mouse ENSMUSG00000031360
Gene ID - Rat ENSRNOG00000004257
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti CTPS2 pAb (ATL-HPA075930)
Datasheet Anti CTPS2 pAb (ATL-HPA075930) Datasheet (External Link)
Vendor Page Anti CTPS2 pAb (ATL-HPA075930) at Atlas Antibodies

Documents & Links for Anti CTPS2 pAb (ATL-HPA075930)
Datasheet Anti CTPS2 pAb (ATL-HPA075930) Datasheet (External Link)
Vendor Page Anti CTPS2 pAb (ATL-HPA075930)