Protein Description: catenin beta interacting protein 1
Gene Name: CTNNBIP1
Alternative Gene Name: ICAT, MGC15093
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028988: 98%, ENSRNOG00000016313: 99%
Entrez Gene ID: 56998
Uniprot ID: Q9NSA3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: CTNNBIP1
Alternative Gene Name: ICAT, MGC15093
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028988: 98%, ENSRNOG00000016313: 99%
Entrez Gene ID: 56998
Uniprot ID: Q9NSA3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | MNREGAPGKSPEEMYIQQKVRVLLMLRKMGSNLTASEEEFLRTYAGVVNSQLSQLPPHSIDQGAEDVVMAFSRSETEDRR |
| Documents & Links for Anti CTNNBIP1 pAb (ATL-HPA067089 w/enhanced validation) | |
| Datasheet | Anti CTNNBIP1 pAb (ATL-HPA067089 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti CTNNBIP1 pAb (ATL-HPA067089 w/enhanced validation) at Atlas |
| Documents & Links for Anti CTNNBIP1 pAb (ATL-HPA067089 w/enhanced validation) | |
| Datasheet | Anti CTNNBIP1 pAb (ATL-HPA067089 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti CTNNBIP1 pAb (ATL-HPA067089 w/enhanced validation) |