Anti CTNNA3 pAb (ATL-HPA061818 w/enhanced validation)

Atlas Antibodies

Catalog No: ATL-HPA061818-25

• 

Product Description

Protein Description: catenin (cadherin-associated protein), alpha 3
Gene Name: CTNNA3
Alternative Gene Name: MGC26194, VR22
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000060843: 92%, ENSRNOG00000054121: 38%
Entrez Gene ID: 29119
Uniprot ID: Q9UI47
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: VSAFQRTFESLKNVANKSDLQKTYQKLGKELENLDYLAFKRQQDLKSPNQRDEIAGARASLKENSPLLHSICS
• Gene Sequence: VSAFQRTFESLKNVANKSDLQKTYQKLGKELENLDYLAFKRQQDLKSPNQRDEIAGARASLKENSPLLHSICS
• Gene ID - Mouse: ENSMUSG00000060843
• Gene ID - Rat: ENSRNOG00000054121
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.