Description
Product Description
Protein Description: catenin (cadherin-associated protein), alpha 3
Gene Name: CTNNA3
Alternative Gene Name: MGC26194, VR22
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000060843: 92%, ENSRNOG00000054121: 38%
Entrez Gene ID: 29119
Uniprot ID: Q9UI47
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: CTNNA3
Alternative Gene Name: MGC26194, VR22
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000060843: 92%, ENSRNOG00000054121: 38%
Entrez Gene ID: 29119
Uniprot ID: Q9UI47
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | VSAFQRTFESLKNVANKSDLQKTYQKLGKELENLDYLAFKRQQDLKSPNQRDEIAGARASLKENSPLLHSICS |
Gene Sequence | VSAFQRTFESLKNVANKSDLQKTYQKLGKELENLDYLAFKRQQDLKSPNQRDEIAGARASLKENSPLLHSICS |
Gene ID - Mouse | ENSMUSG00000060843 |
Gene ID - Rat | ENSRNOG00000054121 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti CTNNA3 pAb (ATL-HPA061818 w/enhanced validation) | |
Datasheet | Anti CTNNA3 pAb (ATL-HPA061818 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti CTNNA3 pAb (ATL-HPA061818 w/enhanced validation) at Atlas Antibodies |
Documents & Links for Anti CTNNA3 pAb (ATL-HPA061818 w/enhanced validation) | |
Datasheet | Anti CTNNA3 pAb (ATL-HPA061818 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti CTNNA3 pAb (ATL-HPA061818 w/enhanced validation) |