Protein Description: connective tissue growth factor
Gene Name: CTGF
Alternative Gene Name: CCN2, IGFBP8
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000019997: 96%, ENSRNOG00000015036: 97%
Entrez Gene ID: 1490
Uniprot ID: P29279
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: CTGF
Alternative Gene Name: CCN2, IGFBP8
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000019997: 96%, ENSRNOG00000015036: 97%
Entrez Gene ID: 1490
Uniprot ID: P29279
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | LPSPDCPFPRRVKLPGKCCEEWVCDEPKDQTVVGPALAAYRLEDTFGPDPTMIRANCLVQTTEWSACSKTCGMG |
| Documents & Links for Anti CTGF pAb (ATL-HPA031075) | |
| Datasheet | Anti CTGF pAb (ATL-HPA031075) Datasheet (External Link) |
| Vendor Page | Anti CTGF pAb (ATL-HPA031075) at Atlas |
| Documents & Links for Anti CTGF pAb (ATL-HPA031075) | |
| Datasheet | Anti CTGF pAb (ATL-HPA031075) Datasheet (External Link) |
| Vendor Page | Anti CTGF pAb (ATL-HPA031075) |
| Citations for Anti CTGF pAb (ATL-HPA031075) – 3 Found |
| Holmes, Brent; Benavides-Serrato, Angelica; Saunders, Jacquelyn T; Kumar, Sunil; Nishimura, Robert N; Gera, Joseph. mTORC2-mediated direct phosphorylation regulates YAP activity promoting glioblastoma growth and invasive characteristics. Neoplasia (New York, N.y.). 2021;23(9):951-965. PubMed |
| Tonner, Henrik; Hunn, Selina; Auler, Nadine; Schmelter, Carsten; Beutgen, Vanessa M; von Pein, Harald D; Pfeiffer, Norbert; Grus, Franz H. A Monoclonal Anti-HMGB1 Antibody Attenuates Neurodegeneration in an Experimental Animal Model of Glaucoma. International Journal Of Molecular Sciences. 2022;23(8) PubMed |
| González-Alonso, Paula; Zazo, Sandra; Martín-Aparicio, Ester; Luque, Melani; Chamizo, Cristina; Sanz-Álvarez, Marta; Minguez, Pablo; Gómez-López, Gonzalo; Cristóbal, Ion; Caramés, Cristina; García-Foncillas, Jesús; Eroles, Pilar; Lluch, Ana; Arpí, Oriol; Rovira, Ana; Albanell, Joan; Piersma, Sander R; Jimenez, Connie R; Madoz-Gúrpide, Juan; Rojo, Federico. The Hippo Pathway Transducers YAP1/TEAD Induce Acquired Resistance to Trastuzumab in HER2-Positive Breast Cancer. Cancers. 2020;12(5) PubMed |