Anti CTDSPL2 pAb (ATL-HPA062198)

Atlas Antibodies

Catalog No: ATL-HPA062198-25

• 

Product Description

Protein Description: CTD (carboxy-terminal domain, RNA polymerase II, polypeptide A) small phosphatase like 2
Gene Name: CTDSPL2
Alternative Gene Name: FLJ10523, HSPC129
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000033411: 97%, ENSRNOG00000022141: 97%
Entrez Gene ID: 51496
Uniprot ID: Q05D32
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: RRKSQVNGEAGSYEMTNQHVKQNGKLEDNPSSGSPPRTTLLGTIFSPVFNFFSPANKNGTSGSDSPGQAVEAEEIVKQLDMEQVDEITTS
• Gene Sequence: RRKSQVNGEAGSYEMTNQHVKQNGKLEDNPSSGSPPRTTLLGTIFSPVFNFFSPANKNGTSGSDSPGQAVEAEEIVKQLDMEQVDEITTS
• Gene ID - Mouse: ENSMUSG00000033411
• Gene ID - Rat: ENSRNOG00000022141
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.