Protein Description: CTD (carboxy-terminal domain, RNA polymerase II, polypeptide A) small phosphatase 1
Gene Name: CTDSP1
Alternative Gene Name: NLIIF, SCP1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026176: 95%, ENSRNOG00000015295: 93%
Entrez Gene ID: 58190
Uniprot ID: Q9GZU7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: CTDSP1
Alternative Gene Name: NLIIF, SCP1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026176: 95%, ENSRNOG00000015295: 93%
Entrez Gene ID: 58190
Uniprot ID: Q9GZU7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | EALPAHSGAPLLVEENGAIPKQTPVQYLLPEAKAQDSDKICVV |
Documents & Links for Anti CTDSP1 pAb (ATL-HPA062654) | |
Datasheet | Anti CTDSP1 pAb (ATL-HPA062654) Datasheet (External Link) |
Vendor Page | Anti CTDSP1 pAb (ATL-HPA062654) at Atlas |
Documents & Links for Anti CTDSP1 pAb (ATL-HPA062654) | |
Datasheet | Anti CTDSP1 pAb (ATL-HPA062654) Datasheet (External Link) |
Vendor Page | Anti CTDSP1 pAb (ATL-HPA062654) |