Protein Description: CDNA FLJ26957 fis, clone SLV00486 {ECO:0000313|EMBL:BAC85360.1}; Uncharacterized protein {ECO:0000313|Ensembl:ENSP00000424007}
Gene Name: CTC-534A2.2
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000044581: 27%, ENSRNOG00000042482: 26%
Entrez Gene ID:
Uniprot ID:
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: CTC-534A2.2
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000044581: 27%, ENSRNOG00000042482: 26%
Entrez Gene ID:
Uniprot ID:
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | HDAKSHSYDCTVDLLEFQPSLKKQHLTWSHTLKEQTNSGNLGKQSEKGKQHKRRSWSISLPSNNCT |
Documents & Links for Anti CTC-534A2.2 pAb (ATL-HPA068764) | |
Datasheet | Anti CTC-534A2.2 pAb (ATL-HPA068764) Datasheet (External Link) |
Vendor Page | Anti CTC-534A2.2 pAb (ATL-HPA068764) at Atlas |
Documents & Links for Anti CTC-534A2.2 pAb (ATL-HPA068764) | |
Datasheet | Anti CTC-534A2.2 pAb (ATL-HPA068764) Datasheet (External Link) |
Vendor Page | Anti CTC-534A2.2 pAb (ATL-HPA068764) |