Protein Description:
Gene Name: CTC-534A2.2
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034731: 29%, ENSRNOG00000010065: 29%
Entrez Gene ID:
Uniprot ID:
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: CTC-534A2.2
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034731: 29%, ENSRNOG00000010065: 29%
Entrez Gene ID:
Uniprot ID:
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | TEVILHYRPCESDPTQLPKIAEKAIQDFPTRPLSRFIPWFPYDGSKLPLRPKRSPPVISEEAAEDVKQYLTISEH |
| Documents & Links for Anti CTC-534A2.2 pAb (ATL-HPA066071) | |
| Datasheet | Anti CTC-534A2.2 pAb (ATL-HPA066071) Datasheet (External Link) |
| Vendor Page | Anti CTC-534A2.2 pAb (ATL-HPA066071) at Atlas |
| Documents & Links for Anti CTC-534A2.2 pAb (ATL-HPA066071) | |
| Datasheet | Anti CTC-534A2.2 pAb (ATL-HPA066071) Datasheet (External Link) |
| Vendor Page | Anti CTC-534A2.2 pAb (ATL-HPA066071) |