Description
Product Description
Protein Description: cancer/testis antigen 2
Gene Name: CTAG2
Alternative Gene Name: CAMEL, CT6.2a, CT6.2b, ESO2, LAGE-1, LAGE-1a, LAGE-1b, LAGE1, MGC138724, MGC3803
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000048573: 30%, ENSRNOG00000009139: 32%
Entrez Gene ID: 30848
Uniprot ID: O75638
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: CTAG2
Alternative Gene Name: CAMEL, CT6.2a, CT6.2b, ESO2, LAGE-1, LAGE-1a, LAGE-1b, LAGE1, MGC138724, MGC3803
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000048573: 30%, ENSRNOG00000009139: 32%
Entrez Gene ID: 30848
Uniprot ID: O75638
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | AQDGRCPCGARRPDSRLLQLHITMPFSSPMEAELVRRILSRDAAPL |
Gene Sequence | AQDGRCPCGARRPDSRLLQLHITMPFSSPMEAELVRRILSRDAAPL |
Gene ID - Mouse | ENSMUSG00000048573 |
Gene ID - Rat | ENSRNOG00000009139 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti CTAG2 pAb (ATL-HPA071467 w/enhanced validation) | |
Datasheet | Anti CTAG2 pAb (ATL-HPA071467 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti CTAG2 pAb (ATL-HPA071467 w/enhanced validation) at Atlas Antibodies |
Documents & Links for Anti CTAG2 pAb (ATL-HPA071467 w/enhanced validation) | |
Datasheet | Anti CTAG2 pAb (ATL-HPA071467 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti CTAG2 pAb (ATL-HPA071467 w/enhanced validation) |