Anti CT55 pAb (ATL-HPA059575)

Atlas Antibodies

Catalog No: ATL-HPA059575-25

• 

Product Description

Protein Description: cancer/testis antigen 55
Gene Name: CT55
Alternative Gene Name: CXorf48, FLJ20527
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000015365: 46%, ENSRNOG00000031093: 46%
Entrez Gene ID: 54967
Uniprot ID: Q8WUE5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: GNVPLKVGQKVNVVVEEDKPHYGLRAIKVDVVPRHLYGAGPSDSGTRVLIG
• Gene Sequence: GNVPLKVGQKVNVVVEEDKPHYGLRAIKVDVVPRHLYGAGPSDSGTRVLIG
• Gene ID - Mouse: ENSMUSG00000015365
• Gene ID - Rat: ENSRNOG00000031093
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.