Protein Description: cystatin C
Gene Name: CST3
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027447: 72%, ENSRNOG00000005195: 73%
Entrez Gene ID: 1471
Uniprot ID: P01034
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: CST3
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027447: 72%, ENSRNOG00000005195: 73%
Entrez Gene ID: 1471
Uniprot ID: P01034
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | SSPGKPPRLVGGPMDASVEEEGVRRALDFAVGEYNKASNDMYHSRALQVVRARKQIVAGVNYFLDVELGRTTCTKTQPNLDNCPFHDQPHLKRKAFCSFQIYAVPWQGTMTLSKSTCQDA |
Gene Sequence | SSPGKPPRLVGGPMDASVEEEGVRRALDFAVGEYNKASNDMYHSRALQVVRARKQIVAGVNYFLDVELGRTTCTKTQPNLDNCPFHDQPHLKRKAFCSFQIYAVPWQGTMTLSKSTCQDA |
Gene ID - Mouse | ENSMUSG00000027447 |
Gene ID - Rat | ENSRNOG00000005195 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti CST3 pAb (ATL-HPA013143 w/enhanced validation) | |
Datasheet | Anti CST3 pAb (ATL-HPA013143 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti CST3 pAb (ATL-HPA013143 w/enhanced validation) at Atlas |
Documents & Links for Anti CST3 pAb (ATL-HPA013143 w/enhanced validation) | |
Datasheet | Anti CST3 pAb (ATL-HPA013143 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti CST3 pAb (ATL-HPA013143 w/enhanced validation) |
Citations for Anti CST3 pAb (ATL-HPA013143 w/enhanced validation) – 3 Found |
Wu, Chih-Ching; Hsu, Chia-Wei; Chen, Chi-De; Yu, Chia-Jung; Chang, Kai-Ping; Tai, Dar-In; Liu, Hao-Ping; Su, Wen-Hui; Chang, Yu-Sun; Yu, Jau-Song. Candidate serological biomarkers for cancer identified from the secretomes of 23 cancer cell lines and the human protein atlas. Molecular & Cellular Proteomics : Mcp. 2010;9(6):1100-17. PubMed |
Sekulovski, Nikola; Whorton, Allison E; Shi, Mingxin; MacLean, James A II; Hayashi, Kanako. Endometriotic inflammatory microenvironment induced by macrophages can be targeted by niclosamide†. Biology Of Reproduction. 2019;100(2):398-408. PubMed |
March, Michael E; Gutierrez-Uzquiza, Alvaro; Snorradottir, Asbjorg Osk; Matsuoka, Leticia S; Balvis, Noelia Fonseca; Gestsson, Thorgeir; Nguyen, Kenny; Sleiman, Patrick M A; Kao, Charlly; Isaksson, Helgi J; Bragason, Birkir Thor; Olafsson, Elias; Palsdottir, Astridur; Hakonarson, Hakon. NAC blocks Cystatin C amyloid complex aggregation in a cell system and in skin of HCCAA patients. Nature Communications. 2021;12(1):1827. PubMed |