Anti CSRNP1 pAb (ATL-HPA058463)

Catalog No:
ATL-HPA058463-25
$447.00

Description

Product Description

Protein Description: cysteine-serine-rich nuclear protein 1
Gene Name: CSRNP1
Alternative Gene Name: AXUD1, DKFZp566F164, FAM130B, TAIP-3, URAX1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032515: 76%, ENSRNOG00000033433: 79%
Entrez Gene ID: 64651
Uniprot ID: Q96S65
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen FAQEQARARHEKLRQRLKEEKLEMLQWKLSAAGVPQAEAGLPPVVDAIDDASVEEDLAVAVAGGRLEEVS
Gene Sequence FAQEQARARHEKLRQRLKEEKLEMLQWKLSAAGVPQAEAGLPPVVDAIDDASVEEDLAVAVAGGRLEEVS
Gene ID - Mouse ENSMUSG00000032515
Gene ID - Rat ENSRNOG00000033433
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti CSRNP1 pAb (ATL-HPA058463)
Datasheet Anti CSRNP1 pAb (ATL-HPA058463) Datasheet (External Link)
Vendor Page Anti CSRNP1 pAb (ATL-HPA058463) at Atlas Antibodies

Documents & Links for Anti CSRNP1 pAb (ATL-HPA058463)
Datasheet Anti CSRNP1 pAb (ATL-HPA058463) Datasheet (External Link)
Vendor Page Anti CSRNP1 pAb (ATL-HPA058463)

Product Description

Protein Description: cysteine-serine-rich nuclear protein 1
Gene Name: CSRNP1
Alternative Gene Name: AXUD1, DKFZp566F164, FAM130B, TAIP-3, URAX1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032515: 76%, ENSRNOG00000033433: 79%
Entrez Gene ID: 64651
Uniprot ID: Q96S65
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen FAQEQARARHEKLRQRLKEEKLEMLQWKLSAAGVPQAEAGLPPVVDAIDDASVEEDLAVAVAGGRLEEVS
Gene Sequence FAQEQARARHEKLRQRLKEEKLEMLQWKLSAAGVPQAEAGLPPVVDAIDDASVEEDLAVAVAGGRLEEVS
Gene ID - Mouse ENSMUSG00000032515
Gene ID - Rat ENSRNOG00000033433
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti CSRNP1 pAb (ATL-HPA058463)
Datasheet Anti CSRNP1 pAb (ATL-HPA058463) Datasheet (External Link)
Vendor Page Anti CSRNP1 pAb (ATL-HPA058463) at Atlas Antibodies

Documents & Links for Anti CSRNP1 pAb (ATL-HPA058463)
Datasheet Anti CSRNP1 pAb (ATL-HPA058463) Datasheet (External Link)
Vendor Page Anti CSRNP1 pAb (ATL-HPA058463)