Anti CSPG5 pAb (ATL-HPA071779 w/enhanced validation)

Atlas Antibodies

Catalog No: ATL-HPA071779-25

• 

Product Description

Protein Description: chondroitin sulfate proteoglycan 5 (neuroglycan C)
Gene Name: CSPG5
Alternative Gene Name: NGC
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032482: 82%, ENSRNOG00000020833: 82%
Entrez Gene ID: 10675
Uniprot ID: O95196
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: EEDDKDAVGGGDLEDENELLVPTGKPGLGPGTGQPTSRWHAVPPQHTLGSVPGSSIALRPRPGEPGRDLASSE
• Gene Sequence: EEDDKDAVGGGDLEDENELLVPTGKPGLGPGTGQPTSRWHAVPPQHTLGSVPGSSIALRPRPGEPGRDLASSE
• Gene ID - Mouse: ENSMUSG00000032482
• Gene ID - Rat: ENSRNOG00000020833
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.