Protein Description: chondroitin sulfate proteoglycan 5 (neuroglycan C)
Gene Name: CSPG5
Alternative Gene Name: NGC
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032482: 82%, ENSRNOG00000020833: 82%
Entrez Gene ID: 10675
Uniprot ID: O95196
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: CSPG5
Alternative Gene Name: NGC
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032482: 82%, ENSRNOG00000020833: 82%
Entrez Gene ID: 10675
Uniprot ID: O95196
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | EEDDKDAVGGGDLEDENELLVPTGKPGLGPGTGQPTSRWHAVPPQHTLGSVPGSSIALRPRPGEPGRDLASSE |
Documents & Links for Anti CSPG5 pAb (ATL-HPA071779 w/enhanced validation) | |
Datasheet | Anti CSPG5 pAb (ATL-HPA071779 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti CSPG5 pAb (ATL-HPA071779 w/enhanced validation) at Atlas |
Documents & Links for Anti CSPG5 pAb (ATL-HPA071779 w/enhanced validation) | |
Datasheet | Anti CSPG5 pAb (ATL-HPA071779 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti CSPG5 pAb (ATL-HPA071779 w/enhanced validation) |