Protein Description: chondroitin sulfate proteoglycan 5 (neuroglycan C)
Gene Name: CSPG5
Alternative Gene Name: NGC
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032482: 77%, ENSRNOG00000020833: 82%
Entrez Gene ID: 10675
Uniprot ID: O95196
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: CSPG5
Alternative Gene Name: NGC
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032482: 77%, ENSRNOG00000020833: 82%
Entrez Gene ID: 10675
Uniprot ID: O95196
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | GGVTAKAGSGDAQALPATLQAPHEVLGQSIMPPAIPEATEASGPPSPTPGDKLSPASELPKESPLEVWLNL |
| Documents & Links for Anti CSPG5 pAb (ATL-HPA067818) | |
| Datasheet | Anti CSPG5 pAb (ATL-HPA067818) Datasheet (External Link) |
| Vendor Page | Anti CSPG5 pAb (ATL-HPA067818) at Atlas |
| Documents & Links for Anti CSPG5 pAb (ATL-HPA067818) | |
| Datasheet | Anti CSPG5 pAb (ATL-HPA067818) Datasheet (External Link) |
| Vendor Page | Anti CSPG5 pAb (ATL-HPA067818) |