Protein Description: casein kinase 2, alpha prime polypeptide
Gene Name: CSNK2A2
Alternative Gene Name: CSNK2A1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000046707: 94%, ENSRNOG00000011933: 94%
Entrez Gene ID: 1459
Uniprot ID: P19784
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: CSNK2A2
Alternative Gene Name: CSNK2A1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000046707: 94%, ENSRNOG00000011933: 94%
Entrez Gene ID: 1459
Uniprot ID: P19784
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | EAMEHPYFYPVVKEQSQPCADNAVLSSGLTAAR |
Documents & Links for Anti CSNK2A2 pAb (ATL-HPA077719) | |
Datasheet | Anti CSNK2A2 pAb (ATL-HPA077719) Datasheet (External Link) |
Vendor Page | Anti CSNK2A2 pAb (ATL-HPA077719) at Atlas |
Documents & Links for Anti CSNK2A2 pAb (ATL-HPA077719) | |
Datasheet | Anti CSNK2A2 pAb (ATL-HPA077719) Datasheet (External Link) |
Vendor Page | Anti CSNK2A2 pAb (ATL-HPA077719) |