Anti CSMD2 pAb (ATL-HPA008622)

Catalog No:
ATL-HPA008622-25
$303.00

Description

Product Description

Protein Description: CUB and Sushi multiple domains 2
Gene Name: CSMD2
Alternative Gene Name: KIAA1884
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028804: 94%, ENSRNOG00000007057: 92%
Entrez Gene ID: 114784
Uniprot ID: Q7Z408
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen RYSAPYCSLPRAPLHGFILGQTSTQPGGSIHFGCNAGYRLVGHSMAICTRHPQGYHLWSEAIPLCQALSCGLPEAPKNGMVFGKEYTVGTKAMYSCSEGYHLQAGAEATAECLDTGLWSNRNVPPQCVPVTCPDVSSISVEH
Gene Sequence RYSAPYCSLPRAPLHGFILGQTSTQPGGSIHFGCNAGYRLVGHSMAICTRHPQGYHLWSEAIPLCQALSCGLPEAPKNGMVFGKEYTVGTKAMYSCSEGYHLQAGAEATAECLDTGLWSNRNVPPQCVPVTCPDVSSISVEH
Gene ID - Mouse ENSMUSG00000028804
Gene ID - Rat ENSRNOG00000007057
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti CSMD2 pAb (ATL-HPA008622)
Datasheet Anti CSMD2 pAb (ATL-HPA008622) Datasheet (External Link)
Vendor Page Anti CSMD2 pAb (ATL-HPA008622) at Atlas Antibodies

Documents & Links for Anti CSMD2 pAb (ATL-HPA008622)
Datasheet Anti CSMD2 pAb (ATL-HPA008622) Datasheet (External Link)
Vendor Page Anti CSMD2 pAb (ATL-HPA008622)

Product Description

Protein Description: CUB and Sushi multiple domains 2
Gene Name: CSMD2
Alternative Gene Name: KIAA1884
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028804: 94%, ENSRNOG00000007057: 92%
Entrez Gene ID: 114784
Uniprot ID: Q7Z408
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen RYSAPYCSLPRAPLHGFILGQTSTQPGGSIHFGCNAGYRLVGHSMAICTRHPQGYHLWSEAIPLCQALSCGLPEAPKNGMVFGKEYTVGTKAMYSCSEGYHLQAGAEATAECLDTGLWSNRNVPPQCVPVTCPDVSSISVEH
Gene Sequence RYSAPYCSLPRAPLHGFILGQTSTQPGGSIHFGCNAGYRLVGHSMAICTRHPQGYHLWSEAIPLCQALSCGLPEAPKNGMVFGKEYTVGTKAMYSCSEGYHLQAGAEATAECLDTGLWSNRNVPPQCVPVTCPDVSSISVEH
Gene ID - Mouse ENSMUSG00000028804
Gene ID - Rat ENSRNOG00000007057
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti CSMD2 pAb (ATL-HPA008622)
Datasheet Anti CSMD2 pAb (ATL-HPA008622) Datasheet (External Link)
Vendor Page Anti CSMD2 pAb (ATL-HPA008622) at Atlas Antibodies

Documents & Links for Anti CSMD2 pAb (ATL-HPA008622)
Datasheet Anti CSMD2 pAb (ATL-HPA008622) Datasheet (External Link)
Vendor Page Anti CSMD2 pAb (ATL-HPA008622)