Description
Product Description
Protein Description: CUB and Sushi multiple domains 2
Gene Name: CSMD2
Alternative Gene Name: KIAA1884
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028804: 94%, ENSRNOG00000007057: 92%
Entrez Gene ID: 114784
Uniprot ID: Q7Z408
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: CSMD2
Alternative Gene Name: KIAA1884
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028804: 94%, ENSRNOG00000007057: 92%
Entrez Gene ID: 114784
Uniprot ID: Q7Z408
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | RYSAPYCSLPRAPLHGFILGQTSTQPGGSIHFGCNAGYRLVGHSMAICTRHPQGYHLWSEAIPLCQALSCGLPEAPKNGMVFGKEYTVGTKAMYSCSEGYHLQAGAEATAECLDTGLWSNRNVPPQCVPVTCPDVSSISVEH |
Gene Sequence | RYSAPYCSLPRAPLHGFILGQTSTQPGGSIHFGCNAGYRLVGHSMAICTRHPQGYHLWSEAIPLCQALSCGLPEAPKNGMVFGKEYTVGTKAMYSCSEGYHLQAGAEATAECLDTGLWSNRNVPPQCVPVTCPDVSSISVEH |
Gene ID - Mouse | ENSMUSG00000028804 |
Gene ID - Rat | ENSRNOG00000007057 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti CSMD2 pAb (ATL-HPA008622) | |
Datasheet | Anti CSMD2 pAb (ATL-HPA008622) Datasheet (External Link) |
Vendor Page | Anti CSMD2 pAb (ATL-HPA008622) at Atlas Antibodies |
Documents & Links for Anti CSMD2 pAb (ATL-HPA008622) | |
Datasheet | Anti CSMD2 pAb (ATL-HPA008622) Datasheet (External Link) |
Vendor Page | Anti CSMD2 pAb (ATL-HPA008622) |