Description
Product Description
Protein Description: colony stimulating factor 2 (granulocyte-macrophage)
Gene Name: CSF2
Alternative Gene Name: GM-CSF, GMCSF
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000018916: 50%, ENSRNOG00000026805: 62%
Entrez Gene ID: 1437
Uniprot ID: P04141
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: CSF2
Alternative Gene Name: GM-CSF, GMCSF
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000018916: 50%, ENSRNOG00000026805: 62%
Entrez Gene ID: 1437
Uniprot ID: P04141
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | PETSCATQIITFESFKENLKDFLLVIPFDCWEPV |
Gene Sequence | PETSCATQIITFESFKENLKDFLLVIPFDCWEPV |
Gene ID - Mouse | ENSMUSG00000018916 |
Gene ID - Rat | ENSRNOG00000026805 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti CSF2 pAb (ATL-HPA062006) | |
Datasheet | Anti CSF2 pAb (ATL-HPA062006) Datasheet (External Link) |
Vendor Page | Anti CSF2 pAb (ATL-HPA062006) at Atlas Antibodies |
Documents & Links for Anti CSF2 pAb (ATL-HPA062006) | |
Datasheet | Anti CSF2 pAb (ATL-HPA062006) Datasheet (External Link) |
Vendor Page | Anti CSF2 pAb (ATL-HPA062006) |