Anti CSF2 pAb (ATL-HPA062006)

Catalog No:
ATL-HPA062006-25
$328.00

Description

Product Description

Protein Description: colony stimulating factor 2 (granulocyte-macrophage)
Gene Name: CSF2
Alternative Gene Name: GM-CSF, GMCSF
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000018916: 50%, ENSRNOG00000026805: 62%
Entrez Gene ID: 1437
Uniprot ID: P04141
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PETSCATQIITFESFKENLKDFLLVIPFDCWEPV
Gene Sequence PETSCATQIITFESFKENLKDFLLVIPFDCWEPV
Gene ID - Mouse ENSMUSG00000018916
Gene ID - Rat ENSRNOG00000026805
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti CSF2 pAb (ATL-HPA062006)
Datasheet Anti CSF2 pAb (ATL-HPA062006) Datasheet (External Link)
Vendor Page Anti CSF2 pAb (ATL-HPA062006) at Atlas Antibodies

Documents & Links for Anti CSF2 pAb (ATL-HPA062006)
Datasheet Anti CSF2 pAb (ATL-HPA062006) Datasheet (External Link)
Vendor Page Anti CSF2 pAb (ATL-HPA062006)

Product Description

Protein Description: colony stimulating factor 2 (granulocyte-macrophage)
Gene Name: CSF2
Alternative Gene Name: GM-CSF, GMCSF
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000018916: 50%, ENSRNOG00000026805: 62%
Entrez Gene ID: 1437
Uniprot ID: P04141
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PETSCATQIITFESFKENLKDFLLVIPFDCWEPV
Gene Sequence PETSCATQIITFESFKENLKDFLLVIPFDCWEPV
Gene ID - Mouse ENSMUSG00000018916
Gene ID - Rat ENSRNOG00000026805
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti CSF2 pAb (ATL-HPA062006)
Datasheet Anti CSF2 pAb (ATL-HPA062006) Datasheet (External Link)
Vendor Page Anti CSF2 pAb (ATL-HPA062006) at Atlas Antibodies

Documents & Links for Anti CSF2 pAb (ATL-HPA062006)
Datasheet Anti CSF2 pAb (ATL-HPA062006) Datasheet (External Link)
Vendor Page Anti CSF2 pAb (ATL-HPA062006)