Protein Description: crystallin beta-gamma domain containing 3
Gene Name: CRYBG3
Alternative Gene Name: DKFZp667G2110
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022723: 77%, ENSRNOG00000001687: 76%
Entrez Gene ID: 131544
Uniprot ID: Q68DQ2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: CRYBG3
Alternative Gene Name: DKFZp667G2110
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022723: 77%, ENSRNOG00000001687: 76%
Entrez Gene ID: 131544
Uniprot ID: Q68DQ2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | VMPNEPTTSNLQVGLWPEKTSFLQKSDLTSKLHSSLKSAYHQYLQTSQSHSSEKGARFGGIFQEPVSKYFRVQDSPGRLSPFIENVDKQTLRCNPR |
Documents & Links for Anti CRYBG3 pAb (ATL-HPA075635) | |
Datasheet | Anti CRYBG3 pAb (ATL-HPA075635) Datasheet (External Link) |
Vendor Page | Anti CRYBG3 pAb (ATL-HPA075635) at Atlas |
Documents & Links for Anti CRYBG3 pAb (ATL-HPA075635) | |
Datasheet | Anti CRYBG3 pAb (ATL-HPA075635) Datasheet (External Link) |
Vendor Page | Anti CRYBG3 pAb (ATL-HPA075635) |