Protein Description: crystallin, alpha B
Gene Name: CRYAB
Alternative Gene Name: CRYA2, HSPB5
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032060: 98%, ENSRNOG00000010524: 98%
Entrez Gene ID: 1410
Uniprot ID: P02511
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: CRYAB
Alternative Gene Name: CRYA2, HSPB5
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032060: 98%, ENSRNOG00000010524: 98%
Entrez Gene ID: 1410
Uniprot ID: P02511
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | KYRIPADVDPLTITSSLSSDGVLTVNGPRKQVSGPERTIPITREEKPAVTAA |
Documents & Links for Anti CRYAB pAb (ATL-HPA057100 w/enhanced validation) | |
Datasheet | Anti CRYAB pAb (ATL-HPA057100 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti CRYAB pAb (ATL-HPA057100 w/enhanced validation) at Atlas |
Documents & Links for Anti CRYAB pAb (ATL-HPA057100 w/enhanced validation) | |
Datasheet | Anti CRYAB pAb (ATL-HPA057100 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti CRYAB pAb (ATL-HPA057100 w/enhanced validation) |