Anti CRYAB pAb (ATL-HPA057100 w/enhanced validation)

Catalog No:
ATL-HPA057100-25
$328.00

On sale now! 25% off. Add item to cart to see discounted price. Valid thru Mar 2025.

Protein Description: crystallin, alpha B
Gene Name: CRYAB
Alternative Gene Name: CRYA2, HSPB5
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032060: 98%, ENSRNOG00000010524: 98%
Entrez Gene ID: 1410
Uniprot ID: P02511
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen KYRIPADVDPLTITSSLSSDGVLTVNGPRKQVSGPERTIPITREEKPAVTAA
Gene Sequence KYRIPADVDPLTITSSLSSDGVLTVNGPRKQVSGPERTIPITREEKPAVTAA
Gene ID - Mouse ENSMUSG00000032060
Gene ID - Rat ENSRNOG00000010524
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti CRYAB pAb (ATL-HPA057100 w/enhanced validation)
Datasheet Anti CRYAB pAb (ATL-HPA057100 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti CRYAB pAb (ATL-HPA057100 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti CRYAB pAb (ATL-HPA057100 w/enhanced validation)
Datasheet Anti CRYAB pAb (ATL-HPA057100 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti CRYAB pAb (ATL-HPA057100 w/enhanced validation)