Anti CRTC3 pAb (ATL-HPA063691)

Atlas Antibodies

Catalog No: ATL-HPA063691-25

• 

Product Description

Protein Description: CREB regulated transcription coactivator 3
Gene Name: CRTC3
Alternative Gene Name: FLJ21868
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030527: 74%, ENSRNOG00000011975: 83%
Entrez Gene ID: 64784
Uniprot ID: Q6UUV7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: SSLTNFFPDVGFDQQSMRPGPAFPQQVPLVQQGSRELQDSFHLRPSPYSNCGSLPNTILPEDSSTS
• Gene Sequence: SSLTNFFPDVGFDQQSMRPGPAFPQQVPLVQQGSRELQDSFHLRPSPYSNCGSLPNTILPEDSSTS
• Gene ID - Mouse: ENSMUSG00000030527
• Gene ID - Rat: ENSRNOG00000011975
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.