Description
Product Description
Protein Description: CREB regulated transcription coactivator 3
Gene Name: CRTC3
Alternative Gene Name: FLJ21868
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030527: 74%, ENSRNOG00000011975: 83%
Entrez Gene ID: 64784
Uniprot ID: Q6UUV7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: CRTC3
Alternative Gene Name: FLJ21868
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030527: 74%, ENSRNOG00000011975: 83%
Entrez Gene ID: 64784
Uniprot ID: Q6UUV7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | SSLTNFFPDVGFDQQSMRPGPAFPQQVPLVQQGSRELQDSFHLRPSPYSNCGSLPNTILPEDSSTS |
Gene Sequence | SSLTNFFPDVGFDQQSMRPGPAFPQQVPLVQQGSRELQDSFHLRPSPYSNCGSLPNTILPEDSSTS |
Gene ID - Mouse | ENSMUSG00000030527 |
Gene ID - Rat | ENSRNOG00000011975 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti CRTC3 pAb (ATL-HPA063691) | |
Datasheet | Anti CRTC3 pAb (ATL-HPA063691) Datasheet (External Link) |
Vendor Page | Anti CRTC3 pAb (ATL-HPA063691) at Atlas Antibodies |
Documents & Links for Anti CRTC3 pAb (ATL-HPA063691) | |
Datasheet | Anti CRTC3 pAb (ATL-HPA063691) Datasheet (External Link) |
Vendor Page | Anti CRTC3 pAb (ATL-HPA063691) |