Protein Description: CREB regulated transcription coactivator 1
Gene Name: CRTC1
Alternative Gene Name: FLJ14027, KIAA0616, MECT1, TORC1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000003575: 81%, ENSRNOG00000022421: 76%
Entrez Gene ID: 23373
Uniprot ID: Q6UUV9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: CRTC1
Alternative Gene Name: FLJ14027, KIAA0616, MECT1, TORC1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000003575: 81%, ENSRNOG00000022421: 76%
Entrez Gene ID: 23373
Uniprot ID: Q6UUV9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | PEEPTFPALSSSSSTGNLAANLTHLGIGGAGQGMSTPGSSPQHRPAGVSPLSLSTEARR |
| Documents & Links for Anti CRTC1 pAb (ATL-HPA063619) | |
| Datasheet | Anti CRTC1 pAb (ATL-HPA063619) Datasheet (External Link) |
| Vendor Page | Anti CRTC1 pAb (ATL-HPA063619) at Atlas |
| Documents & Links for Anti CRTC1 pAb (ATL-HPA063619) | |
| Datasheet | Anti CRTC1 pAb (ATL-HPA063619) Datasheet (External Link) |
| Vendor Page | Anti CRTC1 pAb (ATL-HPA063619) |