![Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251MG sp](https://cdn11.bigcommerce.com/s-ydswqc5qsc/images/stencil/500x659/products/84197/153349/atl-hpa019150_anti-creb1-pab-atl-hpa019150_34978__55252.1681103473.jpg?c=2 "Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251MG sp")
Protein Description: cAMP responsive element binding protein 1
Gene Name: CREB1
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025958: 100%, ENSRNOG00000013412: 100%
Entrez Gene ID: 1385
Uniprot ID: P16220
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: CREB1
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025958: 100%, ENSRNOG00000013412: 100%
Entrez Gene ID: 1385
Uniprot ID: P16220
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human, Mouse, Rat |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | STIAESEDSQESVDSVTDSQKRREILSRRPSYRKILNDLSSDAPGVPRIEEEKSEEETSAPAITTVTVPTPIYQTSSGQYIAITQGGAIQLANNGTDGVQG |
| Documents & Links for Anti CREB1 pAb (ATL-HPA019150) | |
| Datasheet | Anti CREB1 pAb (ATL-HPA019150) Datasheet (External Link) |
| Vendor Page | Anti CREB1 pAb (ATL-HPA019150) at Atlas |
| Documents & Links for Anti CREB1 pAb (ATL-HPA019150) | |
| Datasheet | Anti CREB1 pAb (ATL-HPA019150) Datasheet (External Link) |
| Vendor Page | Anti CREB1 pAb (ATL-HPA019150) |