Anti CRB1 pAb (ATL-HPA063127)

Atlas Antibodies

Catalog No: ATL-HPA063127-25

• 

Product Description

Protein Description: crumbs family member 1, photoreceptor morphogenesis associated
Gene Name: CRB1
Alternative Gene Name: LCA8, RP12
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000063681: 75%, ENSRNOG00000010903: 73%
Entrez Gene ID: 23418
Uniprot ID: P82279
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: NHITLENISSGSSLNVKAGCVRKDWCESQPCQSRGRCINLWLSYQCDCHRPYEGPNCLREYVAGRFGQDDSTGYVIFTLDESYGDTISLSMFVRTL
• Gene Sequence: NHITLENISSGSSLNVKAGCVRKDWCESQPCQSRGRCINLWLSYQCDCHRPYEGPNCLREYVAGRFGQDDSTGYVIFTLDESYGDTISLSMFVRTL
• Gene ID - Mouse: ENSMUSG00000063681
• Gene ID - Rat: ENSRNOG00000010903
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.