Protein Description: crumbs family member 1, photoreceptor morphogenesis associated
Gene Name: CRB1
Alternative Gene Name: LCA8, RP12
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000063681: 75%, ENSRNOG00000010903: 73%
Entrez Gene ID: 23418
Uniprot ID: P82279
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: CRB1
Alternative Gene Name: LCA8, RP12
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000063681: 75%, ENSRNOG00000010903: 73%
Entrez Gene ID: 23418
Uniprot ID: P82279
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | NHITLENISSGSSLNVKAGCVRKDWCESQPCQSRGRCINLWLSYQCDCHRPYEGPNCLREYVAGRFGQDDSTGYVIFTLDESYGDTISLSMFVRTL |
| Documents & Links for Anti CRB1 pAb (ATL-HPA063127) | |
| Datasheet | Anti CRB1 pAb (ATL-HPA063127) Datasheet (External Link) |
| Vendor Page | Anti CRB1 pAb (ATL-HPA063127) at Atlas |
| Documents & Links for Anti CRB1 pAb (ATL-HPA063127) | |
| Datasheet | Anti CRB1 pAb (ATL-HPA063127) Datasheet (External Link) |
| Vendor Page | Anti CRB1 pAb (ATL-HPA063127) |