Protein Description: carnitine palmitoyltransferase 1C
Gene Name: CPT1C
Alternative Gene Name: CPT1P, CPTIC, FLJ23809
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000007783: 91%, ENSRNOG00000026163: 81%
Entrez Gene ID: 126129
Uniprot ID: Q8TCG5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: CPT1C
Alternative Gene Name: CPT1P, CPTIC, FLJ23809
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000007783: 91%, ENSRNOG00000026163: 81%
Entrez Gene ID: 126129
Uniprot ID: Q8TCG5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | AQVRTSLKTQAAEALEAVEGAAFFVSLDAEPAGLTREDPAASLDAYAHALLAG |
| Documents & Links for Anti CPT1C pAb (ATL-HPA063621) | |
| Datasheet | Anti CPT1C pAb (ATL-HPA063621) Datasheet (External Link) |
| Vendor Page | Anti CPT1C pAb (ATL-HPA063621) at Atlas |
| Documents & Links for Anti CPT1C pAb (ATL-HPA063621) | |
| Datasheet | Anti CPT1C pAb (ATL-HPA063621) Datasheet (External Link) |
| Vendor Page | Anti CPT1C pAb (ATL-HPA063621) |