Anti CPT1C pAb (ATL-HPA063621)

Atlas Antibodies

Catalog No: ATL-HPA063621-25

• 

Product Description

Protein Description: carnitine palmitoyltransferase 1C
Gene Name: CPT1C
Alternative Gene Name: CPT1P, CPTIC, FLJ23809
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000007783: 91%, ENSRNOG00000026163: 81%
Entrez Gene ID: 126129
Uniprot ID: Q8TCG5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: AQVRTSLKTQAAEALEAVEGAAFFVSLDAEPAGLTREDPAASLDAYAHALLAG
• Gene Sequence: AQVRTSLKTQAAEALEAVEGAAFFVSLDAEPAGLTREDPAASLDAYAHALLAG
• Gene ID - Mouse: ENSMUSG00000007783
• Gene ID - Rat: ENSRNOG00000026163
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.