Protein Description: carnitine palmitoyltransferase 1B
Gene Name: CPT1B
Alternative Gene Name: CPT1-M, M-CPT1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000078937: 88%, ENSRNOG00000010438: 84%
Entrez Gene ID: 1375
Uniprot ID: Q92523
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: CPT1B
Alternative Gene Name: CPT1-M, M-CPT1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000078937: 88%, ENSRNOG00000010438: 84%
Entrez Gene ID: 1375
Uniprot ID: Q92523
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | VPRVSATIQRYLESVRPLLDDEEYYRMELLAKEFQDKTAPRLQKYLVLKSW |
| Documents & Links for Anti CPT1B pAb (ATL-HPA079265 w/enhanced validation) | |
| Datasheet | Anti CPT1B pAb (ATL-HPA079265 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti CPT1B pAb (ATL-HPA079265 w/enhanced validation) at Atlas |
| Documents & Links for Anti CPT1B pAb (ATL-HPA079265 w/enhanced validation) | |
| Datasheet | Anti CPT1B pAb (ATL-HPA079265 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti CPT1B pAb (ATL-HPA079265 w/enhanced validation) |